Enhanced Recipesculinary collection
Home
CoursesView CuisinesWhat Can I Make?My Kitchen

Bánh Tét nấu Nồi Instant Pot & Cách Nấu Truyền Thống - Cách Làm Chi Tiết - ENGLISH CAPTION

Login to Save
395K views👍 3.1K
KT Food Stories
KT Food Stories
2 recipes on Enhanced Recipes
Follow KT Food Stories to prioritize their recipes in your meal plans, pantry matches, and suggestions

Recipe Information

Recipe Available
Video-Specific Recipe

Bánh Tét

Cultural Context

Bánh Tét is a traditional Vietnamese dish, especially popular during Tết Nguyên Đán, the Lunar New Year. This sticky rice cake symbolizes the Earth and is often filled with mung beans and pork, representing prosperity and abundance. Families gather to prepare Bánh Tét together, sharing stories and traditions, making it a cherished part of Vietnamese culture. Today, variations exist, including sweet versions filled with fruits or nuts, enjoyed not just in Vietnam but by Vietnamese communities worldwide.

VietnameseVNother
360 min
medium
10 servings
Servings4
800 gr Mung Bean (2 bags)
6.5 lbs sweet rice (3 bags)
2 lbs Pork Belly (no skin)
2 tbsp chopped shallots
1 tsp black pepper
2 tsp sugar
1 tsp salt
1 tbsp salt (for rinsing sweet rice)
1 tbsp salt (for rinsing mung bean)
3 bags Frozen Banana Leaves
2 cans Coconut milk (14 oz each)
1/2 soup spoon sugar (for coconut milk)
1 soup spoon sea salt (for coconut milk)
rubber band (for wrapping)

glutinous rice

🥗Healthier: brown rice

💰Cheaper: regular rice

Brown rice adds fiber and nutrients.

pork

🥗Healthier: tofu

💰Cheaper: chicken

Tofu provides a plant-based option.

coconut milk

🥗Healthier: almond milk

💰Cheaper: evaporated milk

Almond milk is lower in calories.

mung beans

🥗Healthier: lentils

💰Cheaper: split peas

Lentils are a good source of protein.

1

Measure 800 gr of mung bean and soak overnight.

2

Rinse mung bean with 1 tbsp salt and drain.

3

Measure 6.5 lbs of sweet rice and rinse with 1 tbsp salt, then drain.

4

Wash, clean, and dry the banana leaves.

5

Cut 3 large banana leaves to about 14 inches for wrapping.

6

Cut smaller banana leaves to about 3 inches for the ends of the cake.

7

Mix the soaked mung bean with 1 tsp salt and steam for 15 minutes.

8

In a pot, add 2 cans of coconut milk, 1/2 soup spoon sugar, and 1 soup spoon sea salt. Stir over medium heat until the water evaporates.

9

Add the drained sweet rice to the pot and stir well, then turn off the heat.

10

Spread 1 cup (1 bowl) of sweet rice evenly in a prepared area, then add the steamed mung bean, followed by 2 lbs of pork belly, then more mung bean, and finally a little more sweet rice on top.

11

Roll the mixture tightly but not too tight, using a rubber band to support the shape, and trim the ends.

12

Place some banana leaves at the bottom of the Instant Pot, add the rolled banana rice cake, fill with hot water to the max line, and add more banana leaves on top.

13

Close the Instant Pot lid, ensuring the valve is set to 'Sealing' mode, and press Manual for 210 minutes.

14

After 210 minutes, allow for a natural pressure release (NPR) for 30 minutes before releasing the valve.

15

For traditional cooking, place the wrapped cake in a pot on the stove and cook for 10 hours, sealing the pot to prevent water evaporation, adding banana leaves at the bottom and top.

16

After cooking, take the cake out and rinse it with water to cool down before unwrapping.

Cooking Techniques

soakingsteamingmarinatinglayeringwrapping

Equipment Needed

Instant Potpot for traditional cooking

Spice Level:

🌶️🌶️🌶️

Also Known As

Banh TetSticky Rice Cake

Other Takes on Pork

(24 videos)

Similar Vietnamese Videos

(24 videos)

Similar Recipes From Other Cuisines

(24 videos)