Enhanced Recipesculinary collection
Home
CoursesView CuisinesWhat Can I Make?My Kitchen

Làm bánh tét siêu dễ, đón Tết rộn ràng // Simple Banh Tet Recipe to Brighten Your Lunar New Year

Login to Save
2K views👍 39
Hương kỷ niệm
Hương kỷ niệm
1 recipes on Enhanced Recipes
Follow Hương kỷ niệm to prioritize their recipes in your meal plans, pantry matches, and suggestions

Recipe Information

Recipe Available
Video-Specific Recipe

Bánh Tét

Cultural Context

Bánh Tét is a traditional Vietnamese dish, especially popular during Tết Nguyên Đán, the Lunar New Year. This sticky rice cake symbolizes the Earth and is often filled with mung beans and pork, representing prosperity and abundance. Families gather to prepare Bánh Tét together, sharing stories and traditions, making it a cherished part of Vietnamese culture. Today, variations exist, including sweet versions filled with fruits or nuts, enjoyed not just in Vietnam but by Vietnamese communities worldwide.

VietnameseVNother
360 min
medium
10 servings
Servings4
2 cups glutinous rice
1 cup mung beans
1 lb pork
10 leaves banana leaves
1 teaspoon salt
1/2 teaspoon pepper
1 cup coconut milk
2 tablespoons sugar
2 shallots
2 tablespoons oil
1 tablespoon seasoning powder
5 pandan leaves

Quantities are estimated based on standard recipes for your convenience. The actual ingredients used in this video are accurate.

glutinous rice

🥗Healthier: brown rice

💰Cheaper: regular rice

Brown rice adds fiber and nutrients.

pork

🥗Healthier: tofu

💰Cheaper: chicken

Tofu provides a plant-based option.

coconut milk

🥗Healthier: almond milk

💰Cheaper: evaporated milk

Almond milk is lower in calories.

mung beans

🥗Healthier: lentils

💰Cheaper: split peas

Lentils are a good source of protein.

1

Wash the glutinous rice and soak it overnight or for 6-8 hours.

2

After soaking, rinse the sticky rice with water once more and drain it in a basket.

3

Wash the mung beans again and cook them in a pot with a little water until soft.

4

Add 1/2 tsp salt to the mung beans while boiling and skim off any foam.

5

Mash the cooked mung beans until smooth.

6

In a pan, add oil and fry shallots until golden brown, then add 1/2 tsp salt, 1/2 tsp seasoning powder, and 1/2 tsp ground pepper.

7

Take half of the fried shallots and mix them with the marinated pork.

8

Cover and refrigerate the mixture until ready to wrap the bánh tét.

9

Add the remaining fried shallots to the mashed mung beans along with 1 tsp seasoning powder, 1/2 tsp pepper, and 1/2 tsp sugar.

10

Divide the mung bean mixture into 4 parts.

11

Take a piece of nylon and place one part of mung beans and pork into it.

12

Stir-fry the sticky rice with coconut milk, 1 tsp salt, and 1/2 tsp sugar to create adhesion.

13

Boil a pot of water with 1 tbsp salt and dip the banana leaves to soften them for wrapping.

14

Wipe the leaves dry and wrap the cake using one leaf vertically and one horizontally.

15

Place glutinous rice and mung beans in the center and wrap it tightly.

16

Place the wrapped cakes into a multi-function pressure cooker.

17

Add pandan leaves for fragrance and pour boiling water up to the max line of the pot.

18

Set the cooker to steam for 2 hours.

19

After 2 hours, let it sit for another 30 minutes before releasing the steam.

Cooking Techniques

soakingsteamingmarinatinglayeringwrapping

Equipment Needed

multi-function pressure cookerpanbasketnylonknife

Spice Level:

🌶️🌶️🌶️

Also Known As

Banh TetSticky Rice Cake

Other Takes on Pork

(24 videos)

Similar Vietnamese Videos

(24 videos)

Similar Recipes From Other Cuisines

(24 videos)