Enhanced Recipesculinary collection
Home
CoursesView CuisinesWhat Can I Make?My Kitchen

Lets Try Bánh Tét - Vietnamese Rice Cake

Login to Save
Chef Buck
Chef Buck
122 recipes on Enhanced Recipes
Follow Chef Buck to prioritize their recipes in your meal plans, pantry matches, and suggestions

Recipe Information

Recipe Available
Video-Specific Recipe

Bánh Tét

Cultural Context

Bánh Tét is a traditional Vietnamese dish, especially popular during Tết Nguyên Đán, the Lunar New Year. This sticky rice cake symbolizes the Earth and is often filled with mung beans and pork, representing prosperity and abundance. Families gather to prepare Bánh Tét together, sharing stories and traditions, making it a cherished part of Vietnamese culture. Today, variations exist, including sweet versions filled with fruits or nuts, enjoyed not just in Vietnam but by Vietnamese communities worldwide.

VietnameseVNother
360 min
medium
10 servings
Servings4
2 cups glutinous rice
1 cup mung beans
1 lb pork
10 large banana leaves
1 teaspoon salt
1/2 teaspoon pepper
1 cup coconut milk
2 tablespoons sugar
1 cup water
2 shallots
3 cloves garlic
3 tablespoons soy sauce
4 oz pork fat

Quantities are estimated based on standard recipes for your convenience. The actual ingredients used in this video are accurate.

glutinous rice

🥗Healthier: brown rice

💰Cheaper: regular rice

Brown rice adds fiber and nutrients.

pork

🥗Healthier: tofu

💰Cheaper: chicken

Tofu provides a plant-based option.

coconut milk

🥗Healthier: almond milk

💰Cheaper: evaporated milk

Almond milk is lower in calories.

mung beans

🥗Healthier: lentils

💰Cheaper: split peas

Lentils are a good source of protein.

1

Soak glutinous rice in water for at least 8 hours or overnight.

2

Drain the rice and steam it for about 30 minutes until translucent.

3

Cook mung beans until soft, then mash and season with salt and pepper.

4

Prepare pork by marinating with soy sauce, garlic, and shallots for 30 minutes.

5

Lay out banana leaves and layer with glutinous rice, followed by a layer of mung beans and marinated pork.

6

Top with another layer of mung beans and cover with more glutinous rice.

7

Wrap tightly in banana leaves and tie with kitchen twine.

8

Boil the wrapped cakes in a large pot of water for at least 6 hours, ensuring they are fully cooked.

9

Remove from pot and let cool for a few hours before slicing.

10

Serve at room temperature or reheat before serving.

Cooking Techniques

soakingsteamingmarinatinglayeringwrapping

Equipment Needed

steamermixing bowlknifekitchen twinebanana leaf

Spice Level:

🌶️🌶️🌶️

Dietary

pescatarian

Also Known As

Banh TetSticky Rice Cake

Other Takes on Pork

(24 videos)

Similar Vietnamese Videos

(24 videos)

Similar Recipes From Other Cuisines

(24 videos)